General Information

  • ID:  hor005627
  • Uniprot ID:  V9QF69
  • Protein name:  Alpha-latrotoxin associated low molecular weight protein
  • Gene name:  NA
  • Organism:  Latrodectus geometricus (Brown widow spider)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Latrodectus (genus), Theridiidae (family), Araneoidea (superfamily), Orbiculariae, Entelegynae, Araneomorphae (suborder), Araneae (order), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IGPADLGCTDMPQAEFDEKNANCEKCGNEEGFGEEMVSRCRDKCFTDNFYQSCVDLLNKVYEEKDVPVPPEE
  • Length:  72
  • Propeptide:  MNKLFFVVFLCLIISVLAIGPADLGCTDMPQAEFDEKNANCEKCGNEEGFGEEMVSRCRDKCFTDNFYQSCVDLLNKVYEEKDVPVPPEE
  • Signal peptide:  MNKLFFVVFLCLIISVLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May increase the toxicity of alpha-latrotoxin and/or other venom components. Is non-toxic to mice and to the cockroach Periplaneta americana
  • Mechanism:  Co-purifies with alpha-latrotoxin.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8MP00-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005627_AF2.pdbhor005627_ESM.pdb

Physical Information

Mass: 939556 Formula: C344H524N90O122S8
Absent amino acids: HW Common amino acids: E
pI: 3.86 Basic residues: 7
Polar residues: 22 Hydrophobic residues: 16
Hydrophobicity: -82.36 Boman Index: -17573
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 45.97
Instability Index: 6642.22 Extinction Coefficient cystines: 3355
Absorbance 280nm: 47.25

Literature

  • PubMed ID:  24316130
  • Title:  Recruitment and diversification of an ecdysozoan family of neuropeptide hormones for black widow spider venom expression.